Recombinant Rat Carbonic anhydrase 1 (Ca1), Unconjugated, E. coli

Catalog Number: BIM-RPC20015
Article Name: Recombinant Rat Carbonic anhydrase 1 (Ca1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20015
Supplier Catalog Number: RPC20015
Alternative Catalog Number: BIM-RPC20015-20UG,BIM-RPC20015-100UG,BIM-RPC20015-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Carbonate dehydratase I
Recombinant Rat Carbonic anhydrase 1 (Ca1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Ca1. Target Synonyms: Carbonate dehydratase I. Accession Number: B0BNN3. Expression Region: 2~261aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 44.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 44.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRT
Target: Ca1