Recombinant Human ATP synthase subunit alpha, mitochondrial (ATP5F1A), Unconjugated, E. coli

Catalog Number: BIM-RPC20007
Article Name: Recombinant Human ATP synthase subunit alpha, mitochondrial (ATP5F1A), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20007
Supplier Catalog Number: RPC20007
Alternative Catalog Number: BIM-RPC20007-20UG,BIM-RPC20007-100UG,BIM-RPC20007-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: ATP synthase alpha chain, ATP synthase alpha chain, mitochondrial, ATP synthase subunit alpha, ATP synthase subunit alpha mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, 1, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 1, cardiac muscle, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 2, non-cardiac muscle-like 2, ATP sythase (F1 ATPase) alpha subunit, ATP5A, Atp5a1, ATP5AL2, ATPA_HUMAN, ATPM, Epididymis secretory sperm binding protein Li 123m, hATP1, HEL-S-123m, MC5DN4, mitochondrial, Mitochondrial ATP synthetase, Mitochondrial ATP synthetase oligomycin resistant, Modifier of Min 2, Modifier of Min 2 mouse homolog, Modifier of Min 2, mouse, homolog of, MOM2, OMR, ORM, OTTHUMP00000163475
Recombinant Human ATP synthase subunit alpha, mitochondrial (ATP5F1A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ATP5F1A. Target Synonyms: ATP synthase alpha chain, ATP synthase alpha chain, mitochondrial, ATP synthase subunit alpha, ATP synthase subunit alpha mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle. Accession Number: P25705. Expression Region: 44~553aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 59.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 59.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGE
Target: ATP5F1A