Recombinant Human ATP synthase subunit alpha, mitochondrial (ATP5F1A), Unconjugated, E. coli
Catalog Number:
BIM-RPC20007
- Images (0)
| Article Name: | Recombinant Human ATP synthase subunit alpha, mitochondrial (ATP5F1A), Unconjugated, E. coli |
| Biozol Catalog Number: | BIM-RPC20007 |
| Supplier Catalog Number: | RPC20007 |
| Alternative Catalog Number: | BIM-RPC20007-20UG,BIM-RPC20007-100UG,BIM-RPC20007-1MG |
| Manufacturer: | Biomatik Corporation |
| Host: | E. coli |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Conjugation: | Unconjugated |
| Alternative Names: | ATP synthase alpha chain, ATP synthase alpha chain, mitochondrial, ATP synthase subunit alpha, ATP synthase subunit alpha mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, 1, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 1, cardiac muscle, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 2, non-cardiac muscle-like 2, ATP sythase (F1 ATPase) alpha subunit, ATP5A, Atp5a1, ATP5AL2, ATPA_HUMAN, ATPM, Epididymis secretory sperm binding protein Li 123m, hATP1, HEL-S-123m, MC5DN4, mitochondrial, Mitochondrial ATP synthetase, Mitochondrial ATP synthetase oligomycin resistant, Modifier of Min 2, Modifier of Min 2 mouse homolog, Modifier of Min 2, mouse, homolog of, MOM2, OMR, ORM, OTTHUMP00000163475 |
| Recombinant Human ATP synthase subunit alpha, mitochondrial (ATP5F1A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ATP5F1A. Target Synonyms: ATP synthase alpha chain, ATP synthase alpha chain, mitochondrial, ATP synthase subunit alpha, ATP synthase subunit alpha mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle. Accession Number: P25705. Expression Region: 44~553aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 59.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures. |
| Molecular Weight: | 59.2kDa |
| Tag: | N-Terminal 6Xhis-Tagged |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity: | >90% by SDS-PAGE |
| Sequence: | QKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGE |
| Target: | ATP5F1A |
