Anti-ENPP3
Catalog Number:
ATA-HPA043772
- Images (9)
| Article Name: | Anti-ENPP3 |
| Biozol Catalog Number: | ATA-HPA043772 |
| Supplier Catalog Number: | HPA043772 |
| Alternative Catalog Number: | ATA-HPA043772-100,ATA-HPA043772-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | B10, CD203c, gp130RB13-6, PD-IBETA, PDNP3 |
| ectonucleotide pyrophosphatase/phosphodiesterase 3 |
| Anti-ENPP3 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 5169 |
| UniProt: | O14638 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ENPP3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human small intestine and placenta tissues using HPA043772 antibody. Corresponding ENPP3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human small intestine shows moderate membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human duodenum shows weak membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in tubules. |
|
|
Immunohistochemical staining of human endometrium shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells. |
|
|
HPA043772-100ul |
|
|
HPA043772-100ul |
|
|
HPA043772-100ul |
Product Guarantee and Expert Support
