Anti-PRPS1
Catalog Number:
ATA-HPA043760
- Images (9)
| Article Name: | Anti-PRPS1 |
| Biozol Catalog Number: | ATA-HPA043760 |
| Supplier Catalog Number: | HPA043760 |
| Alternative Catalog Number: | ATA-HPA043760-100,ATA-HPA043760-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CMTX5, DFN2, DFNX1 |
| phosphoribosyl pyrophosphate synthetase 1 |
| Anti-PRPS1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 5631 |
| UniProt: | None |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LHASQIQVSVEAKYWCLKGGRKGLMMLKTAEKP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PRPS1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. |
|
|
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in stromal cells. |
|
|
Immunohistochemical staining of human prostate shows weak nuclear positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human pancreas shows low positivity in exocrine glandular cells. |
|
|
Immunohistochemical staining of human lymph node shows strong nuclear positivity in non-germinal center cells. |
|
|
HPA043760-100ul |
|
|
|
|
|
HPA043760-100ul |
|
|
HPA043760-100ul |
Product Guarantee and Expert Support
