Recombinant Arabidopsis thaliana Auxin-responsive protein IAA17 (IAA17), Unconjugated, E. coli

Catalog Number: BIM-RPC25792
Article Name: Recombinant Arabidopsis thaliana Auxin-responsive protein IAA17 (IAA17), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25792
Supplier Catalog Number: RPC25792
Alternative Catalog Number: BIM-RPC25792-20UG,BIM-RPC25792-100UG,BIM-RPC25792-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: A. thaliana
Conjugation: Unconjugated
Alternative Names: Auxin response 3 (Indoleacetic acid-induced protein 17, AXR3)
Recombinant Arabidopsis thaliana Auxin-responsive protein IAA17 (IAA17) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: IAA17. Target Synonyms: Auxin response 3 (Indoleacetic acid-induced protein 17, AXR3). Accession Number: P93830. Expression Region: 1~229aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 32.3kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MMGSVELNLRETELCLGLPGGDTVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA
Target: IAA17