Recombinant Arabidopsis thaliana Auxin-responsive protein IAA17 (IAA17), Unconjugated, E. coli

Artikelnummer: BIM-RPC25792
Artikelname: Recombinant Arabidopsis thaliana Auxin-responsive protein IAA17 (IAA17), Unconjugated, E. coli
Artikelnummer: BIM-RPC25792
Hersteller Artikelnummer: RPC25792
Alternativnummer: BIM-RPC25792-20UG,BIM-RPC25792-100UG,BIM-RPC25792-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: A. thaliana
Konjugation: Unconjugated
Alternative Synonym: Auxin response 3 (Indoleacetic acid-induced protein 17, AXR3)
Recombinant Arabidopsis thaliana Auxin-responsive protein IAA17 (IAA17) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: IAA17. Target Synonyms: Auxin response 3 (Indoleacetic acid-induced protein 17, AXR3). Accession Number: P93830. Expression Region: 1~229aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 32.3kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MMGSVELNLRETELCLGLPGGDTVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA
Target-Kategorie: IAA17