Anti-MC1-R Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A89431-100
Article Name: Anti-MC1-R Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A89431-100
Supplier Catalog Number: A89431-100
Alternative Catalog Number: ABC-A89431-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human MC1 Receptor (NP_002377.4).
Conjugation: Unconjugated
Rabbit polyclonal antibody to MC1-R.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 35 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: LVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGAVTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCSW
Target: MC1-R
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000