Anti-RNF31/HOIP Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10351-100
Article Name: Anti-RNF31/HOIP Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10351-100
Supplier Catalog Number: A10351-100
Alternative Catalog Number: ABC-A10351-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human RNF31 (NP_060469.4).
Conjugation: Unconjugated
Rabbit polyclonal antibody to RNF31/HOIP.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 125 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: AAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECA
Target: RNF31/HOIP
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:100