Alpha-2-Macroglobulin (A2M) Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A9752
Article Name: Alpha-2-Macroglobulin (A2M) Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A9752
Supplier Catalog Number: A9752
Alternative Catalog Number: ABB-A9752-100UL,ABB-A9752-20UL,ABB-A9752-1000UL,ABB-A9752-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: A2MD, CPAMD5, FWP007, S863-7, Alpha-2-Macroglobulin (A2M)
The protein encoded by this gene is a protease inhibitor and cytokine transporter. It uses a bait-and-trap mechanism to inhibit a broad spectrum of proteases, including trypsin, thrombin and collagenase. It can also inhibit inflammatory cytokines, and it thus disrupts inflammatory cascades. Mutations in this gene are a cause of alpha-2-macroglobulin deficiency. This gene is implicated in Alzheimers disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits. A related pseudogene, which is also located on the p arm of chromosome 12, has been identified.
Clonality: Monoclonal
Clone Designation: [ARC1734]
Molecular Weight: 163kDa
NCBI: 2
UniProt: P01023
Purity: Affinity purification
Sequence: QAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLL
Target: A2M
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF-P,1:100 - 1:400|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin,Cardiovascular,Blood,Serum Proteins. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using Alpha-2-Macroglobulin (A2M) Rabbit mAb (A9752) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Alpha-2-Macroglobulin (A2M) Rabbit mAb (A9752) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of lysates from Hep G2 cells, using Alpha-2-Macroglobulin (Alpha-2-Macroglobulin (A2M)) Rabbit mAb (A9752) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Alpha-2-Macroglobulin (A2M) Rabbit mAb (A9752) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using Alpha-2-Macroglobulin (A2M) Rabbit mAb (A9752) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded rat liver using Alpha-2-Macroglobulin (Alpha-2-Macroglobulin (A2M)) Rabbit mAb (A9752) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded human liver using Alpha-2-Macroglobulin (Alpha-2-Macroglobulin (A2M)) Rabbit mAb (A9752) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded mouse liver using Alpha-2-Macroglobulin (Alpha-2-Macroglobulin (A2M)) Rabbit mAb (A9752) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.