cGAS Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A8335
- Images (8)
| Article Name: | cGAS Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A8335 |
| Supplier Catalog Number: | A8335 |
| Alternative Catalog Number: | ABB-A8335-100UL,ABB-A8335-20UL,ABB-A8335-1000UL,ABB-A8335-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IF, IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | MB21D1, h-cGAS, C6orf150, cGAS |
| Enables several functions, including 2,3-cyclic GMP-AMP synthase activity, chromatin binding activity, and phosphatidylinositol-4,5-bisphosphate binding activity. Involved in several processes, including cellular response to exogenous dsRNA, positive regulation of intracellular signal transduction, and regulation of defense response. Located in several cellular components, including cytosol, nucleus, and site of double-strand break. |
| Clonality: | Polyclonal |
| Molecular Weight: | 59 kDa |
| NCBI: | 115004 |
| UniProt: | Q8N884 |
| Purity: | Affinity purification |
| Sequence: | KQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF |
| Target: | CGAS |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:4000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from HT-29 cells using cGAS Rabbit pAb (A8335) at 1:1000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
|
|
Western blot analysis of lysates from THP-1 cells using cGAS Rabbit pAb (A8335) at 1:1000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
|
|
Western blot analysis of lysates from HeLa cells usingcGAS Rabbit pAb (A8335) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using cGAS Rabbit pAb (A8335) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon using cGAS Rabbit pAb (A8335) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunofluorescence analysis of NIH/3T3 cells using cGAS Rabbit pAb (A8335) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of PC-12 cells using cGAS Rabbit pAb (A8335) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of U2OS cells using cGAS Rabbit pAb (A8335) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
Product Guarantee and Expert Support
