alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7248
Article Name: alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7248
Supplier Catalog Number: A7248
Alternative Catalog Number: ABB-A7248-20UL,ABB-A7248-100UL,ABB-A7248-500UL,ABB-A7248-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ACTSA, alpha-Smooth Muscle Actin (ACTA2)
This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 59
UniProt: P62736
Purity: Affinity purification
Sequence: MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAP
Target: ACTA2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P,1:20 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Actins,Death Receptor Signaling Pathway,Neuroscience,Neurodegenerative Diseases Markers,Other Neurological disorders,Stem Cells,Mesenchymal Stem Cells,Cardiovascular,Heart,Contractility. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded human colon tissue using alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Western blot analysis of lysates from Mouse heart, using alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human esophagus tissue using alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded human liver cancer tissue using alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded mouse testis tissue using alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded rat colon tissue using alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded Human colon CA using alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded mouse large intestine using alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb (A7248) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.