TTF-1 Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A3292
Article Name: TTF-1 Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A3292
Supplier Catalog Number: A3292
Alternative Catalog Number: ABB-A3292-1000UL,ABB-A3292-20UL,ABB-A3292-100UL,ABB-A3292-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BCH, BHC, NK-2, TEBP, TTF1, NKX2A, NMTC1, T/EBP, TITF1, TTF-1, NKX2.1, NKX2-1
This gene encodes a protein initially identified as a thyroid-specific transcription factor. The encoded protein binds to the thyroglobulin promoter and regulates the expression of thyroid-specific genes but has also been shown to regulate the expression of genes involved in morphogenesis. Mutations and deletions in this gene are associated with benign hereditary chorea, choreoathetosis, congenital hypothyroidism, and neonatal respiratory distress, and may be associated with thyroid cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares the symbol/alias TTF1 with another gene, transcription termination factor 1, which plays a role in ribosomal gene transcription.
Clonality: Monoclonal
Clone Designation: [ARC1942]
Molecular Weight: 39kDa
NCBI: 7080
UniProt: P43699
Purity: Affinity purification
Sequence: MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPY
Target: NKX2-1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IF-P,1:200 - 1:2000|IHC-P,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma tissue using NKX2-1 Rabbit mAb (A3292) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung tissue using NKX2-1 Rabbit mAb (A3292) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Western blot analysis of lysates from Mouse lung using TTF-1 Rabbit mAb (A3292) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Human thyroid tissue using NKX2-1 Rabbit mAb (A3292) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using NKX2-1 Rabbit mAb (A3292) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using NKX2-1 Rabbit mAb (A3292) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Confocal imaging ofparaffin-embedded Mouse thyroid usingNKX2-1 Rabbit mAb (A3292,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
Confocal imaging ofparaffin-embedded Human thyroid usingNKX2-1 Rabbit mAb (A3292,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.