[KD Validated] MRPL21 Rabbit mAb, Unconjugated, Monoclonal

Article Name:	[KD Validated] MRPL21 Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number:	ABB-A26947
Supplier Catalog Number:	A26947
Alternative Catalog Number:	ABB-A26947-20UL,ABB-A26947-1000UL,ABB-A26947-500UL,ABB-A26947-100UL
Manufacturer:	ABclonal
Host:	Rabbit
Category:	Antikörper
Application:	ELISA, IF, IHC-P, WB
Species Reactivity:	Human
Immunogen:	Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation:	Unconjugated
Alternative Names:	L21mt, bL21m, MRP-L21

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Multiple transcript variants encoding different isoforms were identified through sequence analysis although some may be subject to nonsense-mediated decay (NMD).

Clonality:	Monoclonal
Molecular Weight:	13kDa/22kDa
NCBI:	219927
UniProt:	Q7Z2W9
Purity:	Affinity purification
Sequence:	NSQSTSYLPGYVPKTSLSSPPWPEVVLPDPVEETRHHAEVVKKVNEMIVTGQYGRLFAVVHFASRQWKVTSEDLILIGNELDLACGERIRLEKVLLVGADN
Target:	MRPL21

Application Dilute:	WB,1:6000 - 1:26000\|IF/ICC,1:100 - 1:400\|IF-P,1:100 - 1:400\|IHC-P,1:400 - 1:1600\|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes:	Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics & Nuclear Signaling,Endocrine & Metabolism,Mitochondrial metabolism,Mitochondrial translation. Shipping: Ice Bag

	Western blot analysis of lysates from wild type (WT) and MRPL21 knockdown (KD) 293T cells using [KD Validated] MRPL21 Rabbit mAb (A26947) at 1:13000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 45s.
	Western blot analysis of various lysates using [KD Validated] MRPL21 Rabbit mAb (A26947) at 1:13000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 45s.
	Western blot analysis of lysates from Rat heart using [KD Validated] MRPL21 Rabbit mAb (A26947) at 1:6000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 45s.
	Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KD Validated] MRPL21 Rabbit mAb (A26947) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
	Immunohistochemistry analysis of paraffin-embedded Human colon tissue using [KD Validated] MRPL21 Rabbit mAb (A26947) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
	Confocal imaging of HeLa cells using [KD Validated] MRPL21 Rabbit mAb (A26947, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
	Confocal imaging of 293T cells using [KD Validated] MRPL21 Rabbit mAb (A26947, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.
	Confocal imaging of paraffin-embedded Mouse liver tissue using [KD Validated] MRPL21 Rabbit mAb (A26947, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.