CD3 Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A26443
Article Name: CD3 Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A26443
Supplier Catalog Number: A26443
Alternative Catalog Number: ABB-A26443-100UL,ABB-A26443-500UL,ABB-A26443-1000UL,ABB-A26443-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, FC, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: T3E, TCRE, IMD18, CD3epsilon
The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
Clonality: Monoclonal
Molecular Weight: 23kDa
NCBI: 916
UniProt: P07766
Purity: Affinity purification
Sequence: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Target: CD3E
Application Dilute: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|FC,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs,T Cell Receptor Signaling Pathway,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag
Western blot analysis of various lysates using CD3 Rabbit mAb (A26443)at 1:1000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): PC-3
Exposure time: 10s.
Confocal imaging of paraffin-embedded Human spleen tissue using CD3 Rabbit mAb (A26443, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Human tonsil tissue using CD3 Rabbit mAb (A26443, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.
Flow cytometry: 1X10 6 Raji cells (negative control,left) and Human PBMC (right) were surface-stained with CD3 Rabbit mAb (A26443,2 µg/mL,orange line) or Rabbit IgG isotype control (AC042,2 µg/mL,blue line), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10 6 Human PBMC were surface-stained with Rabbit IgG isotype control (AC042,2 µg/mL,left) or CD3 Rabbit mAb (A26443,2 µg/mL,right), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb staining.
Confocal imaging of paraffin-embedded Human tonsil tissue using CD3 Rabbit mAb (A26443, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.
Flow cytometry: 1X10 6 Raji cells (negative control,left) and Human PBMC (right) were surface-stained with CD3 Rabbit mAb (A26443,2 µg/mL,orange line) or Rabbit IgG isotype control (AC042,2 µg/mL,blue line), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10 6 Human PBMC were surface-stained with Rabbit IgG isotype control (AC042,2 µg/mL,left) or CD3 Rabbit mAb (A26443,2 µg/mL,right), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb staining.