[KD Validated] POLR2L Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A25872
Article Name: [KD Validated] POLR2L Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A25872
Supplier Catalog Number: A25872
Alternative Catalog Number: ABB-A25872-20UL,ABB-A25872-500UL,ABB-A25872-1000UL,ABB-A25872-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-67 of human POLR2L (NP_066951.1).
Conjugation: Unconjugated
Alternative Names: RBP10, RPB10, RPABC5, RPB7.6, hRPB7.6, RPB10beta
This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart in yeast, this subunit may be shared by the other two DNA-directed RNA polymerases.
Clonality: Monoclonal
Molecular Weight: 8kDa
NCBI: 5441
UniProt: P62875
Purity: Affinity purification
Sequence: MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Target: POLR2L
Application Dilute: WB,1:2000 - 1:8000|IHC-P,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag
Western blot analysis of lysates from 293T cells transfected with POLR2L siRNA using [KD Validated] POLR2L Rabbit mAb (A25872) at 1:2000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
.Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KD Validated] POLR2L Rabbit mAb (A25872) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Western blot analysis of various lysates using [KD Validated] POLR2L Rabbit mAb (A25872) at 1:2200 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
Immunohistochemistry analysis of paraffin-embedded Human cervix tissue using [KD Validated] POLR2L Rabbit mAb (A25872) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using [KD Validated] POLR2L Rabbit mAb (A25872) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KD Validated] POLR2L Rabbit mAb (A25872) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat skin tissue using [KD Validated] POLR2L Rabbit mAb (A25872) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using [KD Validated] POLR2L Rabbit mAb (A25872) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.