MGLL Rabbit PolymAb, Unconjugated, Monoclonal
Catalog Number:
ABB-A23306PM
- Images (8)
| Article Name: | MGLL Rabbit PolymAb, Unconjugated, Monoclonal |
| Biozol Catalog Number: | ABB-A23306PM |
| Supplier Catalog Number: | A23306PM |
| Alternative Catalog Number: | ABB-A23306PM-500UL,ABB-A23306PM-1000UL,ABB-A23306PM-100UL,ABB-A23306PM-20UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IF, IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | MGL, HUK5, MAGL, HU-K5 |
| This gene encodes a serine hydrolase of the AB hydrolase superfamily that catalyzes the conversion of monoacylglycerides to free fatty acids and glycerol. The encoded protein plays a critical role in several physiological processes including pain and nociperception through hydrolysis of the endocannabinoid 2-arachidonoylglycerol. Expression of this gene may play a role in cancer tumorigenesis and metastasis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Clonality: | Monoclonal |
| Molecular Weight: | 33kDa |
| NCBI: | 11343 |
| UniProt: | Q99685 |
| Purity: | Affinity purification |
| Sequence: | MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAK |
| Target: | MGLL |
| Application Dilute: | WB,1:500 - 1:2000|IF-P,1:50 - 1:200|IHC-P,1:1000- 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Lipases,Neuroscience, Cell Type Marker,Cardiovascular,Lipids,Neuron marker,Synapse marker. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using MGLL Rabbit PolymAb (A23306PM) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates, using MGLL Rabbit PolymAb (A23306PM) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using MGLL Rabbit PolymAb (A23306PM) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human lung tissue using MGLL Rabbit PolymAb (A23306PM) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using MGLL Rabbit PolymAb (A23306PM) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using MGLL Rabbit PolymAb (A23306PM) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using MGLL Rabbit PolymAb (A23306PM) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunofluorescence analysis of paraffin-embedded rat kidney using MGLL Rabbit PolymAb (A23306PM) at dilution of 1:50 (40x lens).Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol. |
Product Guarantee and Expert Support
