DiMethyl-Histone H4-K20 Rabbit mAb, Unconjugated

Catalog Number: ABB-A22269
Article Name: DiMethyl-Histone H4-K20 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A22269
Supplier Catalog Number: A22269
Alternative Catalog Number: ABB-A22269-20UL,ABB-A22269-100UL,ABB-A22269-1000UL,ABB-A22269-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: DOT, ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: H4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, H4C16, HIST2H4, HIST2H4A, DiMethyl-Histone H4-K20
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails, instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated, this record represents the centromeric copy.
Clonality: Monoclonal
Clone Designation: [ARC55059]
Molecular Weight: 11kDa
NCBI: 8359
UniProt: P62805
Purity: Affinity purification
Sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Target: Histone H4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|DB,1:500 - 1:1000|IHC-P,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat,Other (Wide Range Predicted). ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Dot-blot analysis of all sorts of peptides using DiMethyl-Histone H4-K20 Rabbit mAb antibody (A22269) at 1:1000 dilution.
Immunohistochemistry analysis of paraffin-embeddedRat colon tissue usingDiMethyl-Histone H4-K20 Rabbit mAb(A22269) at a dilution of 1:1500 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of various lysates, using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
Immunohistochemistry analysis of paraffin-embeddedHuman small intestine tissue usingDiMethyl-Histone H4-K20 Rabbit mAb(A22269) at a dilution of 1:1500 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman colon carcinoma tissue usingDiMethyl-Histone H4-K20 Rabbit mAb(A22269) at a dilution of 1:1500 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedMouse brain tissue usingDiMethyl-Histone H4-K20 Rabbit mAb(A22269) at a dilution of 1:1500 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedMouse liver tissue usingDiMethyl-Histone H4-K20 Rabbit mAb(A22269) at a dilution of 1:1500 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman breast cancer tissue usingDiMethyl-Histone H4-K20 Rabbit mAb(A22269) at a dilution of 1:1500 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.