[KO Validated] FTO Rabbit mAb, Unconjugated, Monoclonal
Catalog Number:
ABB-A20992
- Images (8)
| Article Name: | [KO Validated] FTO Rabbit mAb, Unconjugated, Monoclonal |
| Biozol Catalog Number: | ABB-A20992 |
| Supplier Catalog Number: | A20992 |
| Alternative Catalog Number: | ABB-A20992-20UL,ABB-A20992-100UL,ABB-A20992-500UL,ABB-A20992-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | GDFD, ALKBH9, BMIQ14, TO |
| This gene is a nuclear protein of the AlkB related non-haem iron and 2-oxoglutarate-dependent oxygenase superfamily but the exact physiological function of this gene is not known. Other non-heme iron enzymes function to reverse alkylated DNA and RNA damage by oxidative demethylation. Studies in mice and humans indicate a role in nervous and cardiovascular systems and a strong association with body mass index, obesity risk, and type 2 diabetes. |
| Clonality: | Monoclonal |
| Clone Designation: | [ARC52114] |
| Molecular Weight: | 58kDa |
| NCBI: | 79068 |
| UniProt: | Q9C0B1 |
| Purity: | Affinity purification |
| Sequence: | STGTLDYILQRCQLALQNVCDDVDNDDVSLKSFEPAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAK |
| Target: | FTO |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:2000|IHC-P,1:100 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Endocrine Metabolism,Lipid Metabolism,Endocrine and metabolic diseases,Diabetes,Obesity,Neuroscience,Cardiovascular,Heart,Cardiovascular diseases,Heart disease. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using [KO Validated] FTO Rabbit mAb (A20992) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
|
|
Western blot analysis of lysates from wild type (WT) and FTO knockout (KO) 293T cells, using [KO Validated] FTO Rabbit mAb (A20992) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s. |
|
|
Western blot analysis of various lysates, using [KO Validated] FTO Rabbit mAb (A20992) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using [KO Validated] FTO Rabbit mAb (A20992) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon using [KO Validated] FTO Rabbit mAb (A20992) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse brain using [KO Validated] FTO Rabbit mAb (A20992) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat brain using [KO Validated] FTO Rabbit mAb (A20992) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat kidney using [KO Validated] FTO Rabbit mAb (A20992) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
Product Guarantee and Expert Support
