LDL Receptor (LDLR) Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A20808
Article Name: LDL Receptor (LDLR) Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A20808
Supplier Catalog Number: A20808
Alternative Catalog Number: ABB-A20808-20UL,ABB-A20808-100UL,ABB-A20808-500UL,ABB-A20808-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FH, FHC, FHCL1, LDLCQ2, LDL Receptor (LDLR)
The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. The encoded protein is normally bound at the cell membrane, where it binds low density lipoprotein/cholesterol and is taken into the cell. Lysosomes release the cholesterol, which is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia. Alternate splicing results in multiple transcript variants.
Clonality: Monoclonal
Clone Designation: [ARC51372]
Molecular Weight: 95kDa
NCBI: 3949
UniProt: P01130
Purity: Affinity purification
Sequence: TVEIVTMSHQALGDVAGRGNEKKPSSVRALSIVLPIVLLVFLCLGVFLLWKNWRLKNINSINFDNPVYQKTTEDEVHICHNQDGYSYPSRQMVSLEDDVA
Target: LDLR
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|IHC-P,1:400 - 1:1200|IF/ICC,1:200 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Cardiovascular,Heart,Lipids,Cardiovascular diseases,Heart disease. Shipping: Ice Bag
Western blot analysis of lysates from A-431 cells, using LDL Receptor (LDLR) Rabbit mAb (A20808) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using LDL Receptor (LDLR) Rabbit mAb (A20808) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Western blot analysis of various lysates using LDL Receptor (LDLR) Rabbit mAb (A20808) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using LDL Receptor (LDLR) Rabbit mAb (A20808) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using LDL Receptor (LDLR) Rabbit mAb (A20808) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using LDL Receptor (LDLR) Rabbit mAb (A20808) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using LDL Receptor (LDLR) Rabbit mAb (A20808) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Confocal imaging of Hep G2 cells using LDL Receptor (LDLR) Rabbit mAb (A20808, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.