Parvalbumin/PVALB Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A19098
Article Name: Parvalbumin/PVALB Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A19098
Supplier Catalog Number: A19098
Alternative Catalog Number: ABB-A19098-100UL,ABB-A19098-20UL,ABB-A19098-1000UL,ABB-A19098-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: D22S749, Parvalbumin (PVALB)
The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation. Alternative splicing results in multiple transcript variants.
Clonality: Monoclonal
Clone Designation: [ARC0385]
Molecular Weight: 12kDa
NCBI: 5816
UniProt: P20472
Purity: Affinity purification
Sequence: MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Target: PVALB
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IF-F,1:200 - 1:800|IF-P,1:100 - 1:1000|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience, Cell Type Marker,Calcium Signaling,Neuron marker. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Parvalbumin (PVALB) Rabbit mAb (A19098) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Parvalbumin (PVALB) Rabbit mAb (A19098) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Western blot analysis of various lysates using Parvalbumin (PVALB) Rabbit mAb (A19098) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Human appendix tissue using Parvalbumin (PVALB) Rabbit mAb (A19098) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Parvalbumin (PVALB) Rabbit mAb (A19098) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Human kidney tissue using Parvalbumin/PVALB Rabbit mAb (A19098, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Mouse brain tissue using Parvalbumin/PVALB Rabbit mAb (A19098, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Rat brain tissue using Parvalbumin/PVALB Rabbit mAb (A19098, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.