betaIII-Tubulin Mouse mAb, Monoclonal

Catalog Number: ABB-A18132
Article Name: betaIII-Tubulin Mouse mAb, Monoclonal
Biozol Catalog Number: ABB-A18132
Supplier Catalog Number: A18132
Alternative Catalog Number: ABB-A18132-500UL,ABB-A18132-100UL,ABB-A18132-1000UL,ABB-A18132-20UL
Manufacturer: ABclonal
Host: Mouse
Category: Antikörper
Application: ELISA, IF, IHC-P
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: CDCBM, FEOM3, TUBB4, CDCBM1, CFEOM3, beta-4, CFEOM3A, [KD Validated] betaIII-Tubulin
This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.
Clonality: Monoclonal
Molecular Weight: 50kDa
NCBI: 10381
UniProt: Q13509
Purity: Affinity purification
Sequence: SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF
Target: TUBB3
Application Dilute: IF-F,1:200 - 1:2000|IF-P,1:50 - 1:200|IHC-P,1:1000 - 1:10000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cytoskeleton,Microtubules,Neuroscience, Cell Type Marker,Neuron marker. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using betaIII-Tubulin Mouse mAb (A18132) at a dilution of 1:4500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using betaIII-Tubulin Mouse mAb (A18132) at a dilution of 1:4500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using betaIII-Tubulin Mouse mAb (A18132) at a dilution of 1:4500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human brain tissue using betaIII-Tubulin Mouse mAb (A18132) at a dilution of 1:4500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded mouse brain using betaIII-Tubulin Mouse mAb (A18132) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Confocal imaging of frozen sections of Mouse brain tissue using betaIII-Tubulin Mouse mAb (A18132, dilution 1:500) followed by a further incubation with Cy3-conjugated Goat anti-Mouse IgG (H+L) (AS008, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Mouse testis tissue using betaIII-Tubulin Mouse mAb (A18132, dilution 1:200) followed by a further incubation with Cy3-conjugated Goat anti-Mouse IgG (H+L) (AS008, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.