pAbPC1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14872
Article Name: pAbPC1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14872
Supplier Catalog Number: A14872
Alternative Catalog Number: ABB-A14872-100UL,ABB-A14872-20UL,ABB-A14872-1000UL,ABB-A14872-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PAB1, PABP, PABP1, PABPC2, PABPL1, pAbPC1
This gene encodes a poly(A) binding protein. The protein shuttles between the nucleus and cytoplasm and binds to the 3 poly(A) tail of eukaryotic messenger RNAs via RNA-recognition motifs. The binding of this protein to poly(A) promotes ribosome recruitment and translation initiation, it is also required for poly(A) shortening which is the first step in mRNA decay. The gene is part of a small gene family including three protein-coding genes and several pseudogenes.
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 26986
UniProt: P11940
Purity: Affinity purification
Sequence: VTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNM
Target: PABPC1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Translation Control,Regulation of eIF4 and p70 S6 Kinase. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Rat testis using pAbPC1 Rabbit pAb (A14872) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human esophageal using pAbPC1 Rabbit pAb (A14872) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Western blot analysis of various lysates, using pAbPC1 Rabbit pAb (A14872) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded Mouse testis using pAbPC1 Rabbit pAb (A14872) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis of MCF7 cells using pAbPC1 Rabbit pAb (A14872) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using pAbPC1 Rabbit pAb (A14872) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using pAbPC1 Rabbit pAb (A14872) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.