GFAP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14673
Article Name: GFAP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14673
Supplier Catalog Number: A14673
Alternative Catalog Number: ABB-A14673-100UL,ABB-A14673-20UL,ABB-A14673-500UL,ABB-A14673-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ALXDRD, GFAP
This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 2670
UniProt: P14136
Purity: Affinity purification
Sequence: QDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
Target: GFAP
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Intermediate Filaments,Neuroscience, Cell Type Marker,Stem Cells,Neural Stem Cells,Astrocyte marker. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Rat brain using GFAP Rabbit pAb (A14673) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat cerebellum using GFAP Rabbit pAb (A14673) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Western blot analysis of various lysates using GFAP Rabbit pAb (A14673) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Mouse brain using GFAP Rabbit pAb (A14673) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded mouse brain using GFAP Rabbit pAb (A14673) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Immunofluorescence analysis of paraffin-embedded rat brain using GFAP Rabbit pAb (A14673) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Immunofluorescence analysis of U-251MG cells using GFAP Rabbit pAb (A14673) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.