DNA Ligase III/LIG3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A13507
- Images (7)
| Article Name: | DNA Ligase III/LIG3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A13507 |
| Supplier Catalog Number: | A13507 |
| Alternative Catalog Number: | ABB-A13507-20UL,ABB-A13507-100UL,ABB-A13507-1000UL,ABB-A13507-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IF, IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | LIG2, MTDPS20, LIG3alpha, DNA Ligase III/LIG3 |
| This gene is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Clonality: | Polyclonal |
| Molecular Weight: | 113kDa |
| NCBI: | 3980 |
| UniProt: | P49916 |
| Purity: | Affinity purification |
| Sequence: | CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQE |
| Target: | LIG3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using DNA Ligase III/LIG3 Rabbit pAb (A13507) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat brain using DNA Ligase III/LIG3 Rabbit pAb (A13507) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates using (A13507) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat liver using DNA Ligase III/LIG3 Rabbit pAb (A13507) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat ovary using DNA Ligase III/LIG3 Rabbit pAb (A13507) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunofluorescence analysis of NIH/3T3 cells using DNA Ligase III/LIG3 Rabbit pAb (A13507) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of PC-12 cells using DNA Ligase III/LIG3 Rabbit pAb (A13507) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
Product Guarantee and Expert Support
