CHD4 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A11574
- Images (7)
| Article Name: | CHD4 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A11574 |
| Supplier Catalog Number: | A11574 |
| Alternative Catalog Number: | ABB-A11574-20UL,ABB-A11574-100UL,ABB-A11574-1000UL,ABB-A11574-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IF, IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CHD-4, Mi-2b, SIHIWES, Mi2-BETA, CHD4 |
| The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. Somatic mutations in this gene are associated with serous endometrial tumors. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Clonality: | Polyclonal |
| Molecular Weight: | 218kDa |
| NCBI: | 1108 |
| UniProt: | Q14839 |
| Purity: | Affinity purification |
| Sequence: | ELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPAEDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKK |
| Target: | CHD4 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling,Immunology Inflammation. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat liver using CHD4 Rabbit pAb (A11574) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human oophoroma using CHD4 Rabbit pAb (A11574) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Western blot analysis of various lysates using CHD4 Rabbit pAb (A11574) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse liver using CHD4 Rabbit pAb (A11574) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunofluorescence analysis of C6 cells using CHD4 Rabbit pAb (A11574) at dilution of 1:100. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of L929 cells using CHD4 Rabbit pAb (A11574) at dilution of 1:100. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of U20S cells using CHD4 Rabbit pAb (A11574) at dilution of 1:100. Blue: DAPI for nuclear staining. |
Product Guarantee and Expert Support
