LC3B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A11282
Article Name: LC3B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A11282
Supplier Catalog Number: A11282
Alternative Catalog Number: ABB-A11282-20UL,ABB-A11282-100UL,ABB-A11282-1000UL,ABB-A11282-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LC3B, ATG8F, MAP1LC3B-a, MAP1A/1BLC3
The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 81631
UniProt: Q9GZQ8
Purity: Affinity purification
Sequence: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYE
Target: MAP1LC3B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Cytoskeleton,Microtubules,Endocrine Metabolism,Mitochondrial metabolism,Neuroscience,Cardiovascular,Heart. Shipping: Ice Bag
Western blot analysis of lysates from 293T cells usingLC3B Rabbit pAb (A11282) at1:1000 dilution. 293T cells were treated with Chloroquine (50 µM) at 37°C for 20 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:60s.
Western blot analysis of lysates from C6 cells usingLC3B Rabbit pAb (A11282) at1:1000 dilution. C6 cells were treated with Chloroquine (50 µM) at 37°C for 20 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:60s.
Western blot analysis of lysates from NIH/3T3 cells usingLC3B Rabbit pAb (A11282) at1:1000 dilution. NIH/3T3 cells were treated with Chloroquine (50 µM) at 37°C for 20 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:60s.
Western blot analysis of various lysates using LC3B Rabbit pAb (A11282)at 1:1000 dilutionincubated overnight at 4°C. 293T,NIH/3T3,C6 cells were treated with Chloroquine at 37°C for 48 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded Mouse brain using LC3B Rabbit pAb (A11282) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain using LC3B Rabbit pAb (A11282) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of 293T and 293T Chloroquine cells using LC3B Rabbit pAb (A11282) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.