MAGED1/NRAGE Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1092
- Images (8)
| Article Name: | MAGED1/NRAGE Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1092 |
| Supplier Catalog Number: | A1092 |
| Alternative Catalog Number: | ABB-A1092-20UL,ABB-A1092-100UL,ABB-A1092-500UL,ABB-A1092-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | NRAGE, DLXIN-1, MAGED1/NRAGE |
| This gene is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homology with members of the MAGE family, it is expressed in almost all normal adult tissues. This gene has been demonstrated to be involved in the p75 neurotrophin receptor mediated programmed cell death pathway. Three transcript variants encoding two different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 86kDa |
| NCBI: | 9500 |
| UniProt: | Q9Y5V3 |
| Purity: | Affinity purification |
| Sequence: | EAVLWEALRKMGLRPGVRHPLLGDLRKLLTYEFVKQKYLDYRRVPNSNPPEYEFLWGLRSYHETSKMKVLRFIAEVQKRDPRDWTAQFMEAADEALDALDAAAAEAEARAEARTRMGIGDEAVSGPWSWDDIEFELLTWDEEGDFGDPWSRIPFTFWARYHQNARSRFPQTFAGPIIGPGGTASANFAANFGAIGFFWVE |
| Target: | MAGED1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:100 - 1:500|IHC-P,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,p53 pathway,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using MAGED1/NRAGE Rabbit pAb (A1092) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human placenta using MAGED1/NRAGE Rabbit pAb (A1092) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Western blot analysis of lysates from A-549 cells, using MAGED1/NRAGE Rabbit pAb (A1092) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human tonsil using MAGED1/NRAGE Rabbit pAb (A1092) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse brain using MAGED1/NRAGE Rabbit pAb (A1092) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse spleen using MAGED1/NRAGE Rabbit pAb (A1092) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat brain using MAGED1/NRAGE Rabbit pAb (A1092) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat lung using MAGED1/NRAGE Rabbit pAb (A1092) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
Product Guarantee and Expert Support
