CLDN5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A10207
Article Name: CLDN5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A10207
Supplier Catalog Number: A10207
Alternative Catalog Number: ABB-A10207-20UL,ABB-A10207-100UL,ABB-A10207-500UL,ABB-A10207-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AWAL, BEC1, TMVCF, TMDVCF, CPETRL1, CLDN5
This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 7122
UniProt: O00501
Purity: Affinity purification
Sequence: LTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
Target: CLDN5
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|IHC-P,1:1000 - 1:4000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Tight Junctions,Cytoskeleton. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using CLDN5 Rabbit pAb (A10207) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using CLDN5 Rabbit pAb (A10207) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Western blot analysis of various lysates, using CLDN5 Rabbit pAb (A10207) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using CLDN5 Rabbit pAb (A10207) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using CLDN5 Rabbit pAb (A10207) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunofluorescence analysis of NIH/3T3 cells using CLDN5 Rabbit pAb (A10207) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using CLDN5 Rabbit pAb (A10207) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.