UVRAG (UV Radiation Resistance-associated Gene Protein, p63, DHTX, VPS38), Clone: [2E8], Mouse, Monoclonal

Artikelnummer: USB-135191
Artikelname: UVRAG (UV Radiation Resistance-associated Gene Protein, p63, DHTX, VPS38), Clone: [2E8], Mouse, Monoclonal
Artikelnummer: USB-135191
Hersteller Artikelnummer: 135191
Alternativnummer: USB-135191-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant corresponding to aa601-699 from human UVRAG (NP_003360) with GST tag. MW of the GST tag alone is 26kD.
UVRAG complements the ultraviolet sensitivity of xeroderma pigmentosum group C cells and encodes a protein with a C2 domain. The protein activates the Beclin1-PI(3)KC3 complex, promoting autophagy and suppressing the proliferation and tumorigenicity of human colon cancer cells. Chromosomal aberrations involving this gene are associated with left-right axis malformation and mutations in this gene have been associated with colon cancer. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LPSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFRRPRRSSDK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [2E8]
NCBI: 003369
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.