USP9Y (Probable Ubiquitin Carboxyl-terminal Hydrolase FAF-Y, Deubiquitinating Enzyme FAF-Y, Fat Facets Protein-related, Y-linked, Ubiquitin Thioesterase FAF-Y, Ubiquitin-specific Protease 9, Y Chromosome, Ubiquitin-specific-proces

Artikelnummer: USB-135186-BIOTIN
Artikelname: USP9Y (Probable Ubiquitin Carboxyl-terminal Hydrolase FAF-Y, Deubiquitinating Enzyme FAF-Y, Fat Facets Protein-related, Y-linked, Ubiquitin Thioesterase FAF-Y, Ubiquitin-specific Protease 9, Y Chromosome, Ubiquitin-specific-proces
Artikelnummer: USB-135186-BIOTIN
Hersteller Artikelnummer: 135186-Biotin
Alternativnummer: USB-135186-BIOTIN-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant corresponding to aa3-91 from USP9Y (NP_004645) with GST tag. MW of the GST tag alone is 26kD.
May function as a ubiquitin-protein or polyubiquitin hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. May therefore play an important role regulatory role at the level of protein turnover by preventing degradation of proteins through the removal of conjugated ubiquitin. Essential component of TGF-beta/BMP signaling cascade. Deubiquitinates monoubiquitinated SMAD4, opposing the activity of E3 ubiquitin-protein ligase TRIM33. Monoubiquitination of SMAD4 hampers its ability to form a stable complex with activated SMAD2/3 resulting in inhibition of TGF-beta/BMP signaling cascade. Deubiqitination of SMAD4 by USP9X re-empowers its competence to mediate TGF-beta signaling. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA sequence: AITHGSPVGGNDSQGQVLDGQSQHLFQQNQTSSPDSSNENSVATPPPEEQGQGDAPPQHEDEEPAFPHTELANLDDMINRPRWVVPVL* Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2D3]
NCBI: 004654
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.