USP6 (Ubiquitin-specific-processing Protease 6, Ubiquitin Carboxyl-terminal Hydrolase 6, Deubiquitinating Enzyme 6, HRP1, Proto-oncogene TRE-2, TRE2, TRE17, Ubiquitin Thioesterase 6) (FITC), Clone: [1F5], Mouse, Monoclonal100 u

Artikelnummer: USB-135184-FITC
Artikelname: USP6 (Ubiquitin-specific-processing Protease 6, Ubiquitin Carboxyl-terminal Hydrolase 6, Deubiquitinating Enzyme 6, HRP1, Proto-oncogene TRE-2, TRE2, TRE17, Ubiquitin Thioesterase 6) (FITC), Clone: [1F5], Mouse, Monoclonal100 u
Artikelnummer: USB-135184-FITC
Hersteller Artikelnummer: 135184-FITC
Alternativnummer: USB-135184-FITC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: Partial recombinant corresponding to aa2-90 from USP6 (NP_004496) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DMVENADSLQAQERKDILMKYDKGHRAGLPEDKGPEPVGINSSIDRFGILHETELPPVTAREAKKIRREMTRTSKWMEMLGEWETYKH Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [1F5]
NCBI: 004505
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).