USP48 (Ubiquitin Carboxyl-terminal Hydrolase 48, Deubiquitinating Enzyme 48, Ubiquitin Thioesterase 48, Ubiquitin-specific-processing Protease 48, USP31, DKFZp762M1713, MGC132556, MGC14879) (MaxLight 550), Clone: [3G4], Mouse, Mon

Artikelnummer: USB-135180-ML550
Artikelname: USP48 (Ubiquitin Carboxyl-terminal Hydrolase 48, Deubiquitinating Enzyme 48, Ubiquitin Thioesterase 48, Ubiquitin-specific-processing Protease 48, USP31, DKFZp762M1713, MGC132556, MGC14879) (MaxLight 550), Clone: [3G4], Mouse, Mon
Artikelnummer: USB-135180-ML550
Hersteller Artikelnummer: 135180-ML550
Alternativnummer: USB-135180-ML550-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IHC, WB
Immunogen: Partial recombinant corresponding to aa110-220 from human USP48 (NP_115612) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor(TM)546, 555, DyLight(TM)549 , Cy3(TM), TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm), Emission (575nm), Extinction Coefficient 150,000. This gene encodes a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq] Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: NLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAY Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [3G4]
NCBI: 032236
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)550.