USP4 (Ubiquitin-specific-processing Protease 4, Ubiquitin Carboxyl-terminal Hydrolase 4, Deubiquitinating Enzyme 4, Ubiquitin Thioesterase 4, Ubiquitous Nuclear Protein Homolog, UNP, UNPH) (FITC), Clone: [5E12], Mouse, Monoclonal

Artikelnummer: USB-135175-FITC
Artikelname: USP4 (Ubiquitin-specific-processing Protease 4, Ubiquitin Carboxyl-terminal Hydrolase 4, Deubiquitinating Enzyme 4, Ubiquitin Thioesterase 4, Ubiquitous Nuclear Protein Homolog, UNP, UNPH) (FITC), Clone: [5E12], Mouse, Monoclonal
Artikelnummer: USB-135175-FITC
Hersteller Artikelnummer: 135175-FITC
Alternativnummer: USB-135175-FITC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: Partial recombinant corresponding to aa676-773 from human USP4 (NP_003354) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: FLISA: 10ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: ETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKK Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [5E12]
NCBI: 003363
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).