USP39 (Inactive Ubiquitin-specific Peptidase 39, U4/U6.U5 tri-snRNP-associated Protein 2, CGI-21, HSPC332, PRO2855, SAD1 Homolog, U4/U6.U5 tri-snRNP-associated 65kD Protein, 65K, SNRNP65) (APC), Clone: [4G11], Mouse, Monoclonal

Artikelnummer: USB-135174-APC
Artikelname: USP39 (Inactive Ubiquitin-specific Peptidase 39, U4/U6.U5 tri-snRNP-associated Protein 2, CGI-21, HSPC332, PRO2855, SAD1 Homolog, U4/U6.U5 tri-snRNP-associated 65kD Protein, 65K, SNRNP65) (APC), Clone: [4G11], Mouse, Monoclonal
Artikelnummer: USB-135174-APC
Hersteller Artikelnummer: 135174-APC
Alternativnummer: USB-135174-APC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: Partial recombinant corresponding to aa466-565 from human USP39 (NP_006581) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [4G11]
NCBI: 006590
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).