USP33 (Ubiquitin-specific-processing Protease 33, Ubiquitin Carboxyl-terminal Hydrolase 33, Deubiquitinating Enzyme 33, Ubiquitin Thioesterase 33, VHL-interacting Deubiquitinating Enzyme 1, VDU1, hVDU1, KIAA1097) (HRP), Clone: [5B

Artikelnummer: USB-135171-HRP
Artikelname: USP33 (Ubiquitin-specific-processing Protease 33, Ubiquitin Carboxyl-terminal Hydrolase 33, Deubiquitinating Enzyme 33, Ubiquitin Thioesterase 33, VHL-interacting Deubiquitinating Enzyme 1, VDU1, hVDU1, KIAA1097) (HRP), Clone: [5B
Artikelnummer: USB-135171-HRP
Hersteller Artikelnummer: 135171-HRP
Alternativnummer: USB-135171-HRP-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IHC, IP, WB
Immunogen: Partial recombinant corresponding to aa327-427 from USP33 (NP_055832) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQIL* Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [5B5]
NCBI: 015017
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).