Partial recombinant corresponding to aa1-53 from human P2RY1 (NP_002554) with GST tag. MW of the GST tag alone is 26kD.
P2Y1 is a Purinergic Receptor that causes a change in platelet shape and potentially leads to platelet aggregation by binding ADP, which results in the mobilization of intracellular calcium ions via activation of phospholipase C. This receptor also mediates the release of the relaxing factor nitric oxide and may be involved in the modulation of neuronal signal transmission. P2Y1 has been reported to be expressed in tissues throughout the body, particularly brain. ESTs have been isolated from human embryo, lung, and placenta libraries. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFY Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
