OTX1 (Homeobox Protein OTX1, Orthodenticle Homolog 1, FLJ38361, MGC15736) (Biotin), Clone: [1F2], Mouse, Monoclonal

Artikelnummer: USB-130774-BIOTIN
Artikelname: OTX1 (Homeobox Protein OTX1, Orthodenticle Homolog 1, FLJ38361, MGC15736) (Biotin), Clone: [1F2], Mouse, Monoclonal
Artikelnummer: USB-130774-BIOTIN
Hersteller Artikelnummer: 130774-Biotin
Alternativnummer: USB-130774-BIOTIN-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Immunogen: Partial recombinant corresponding to aa10-117 from human OTX1 (NP_055377) with GST tag. MW of the GST tag alone is 26kD.
This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVR Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [1F2]
NCBI: 014562
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.