Partial recombinant corresponding to aa423-494 from human OTOP2 (NP_835454) with GST tag. MW of the GST tag alone is 26kD.
Otopetrins are multi-transmembrane domain proteins that share conserved gene and protein structure and are possibly involved in the formation of otoconia and otoliths. Located in the utricle and saccule of the inner ear, otoconia are complex calcium carbonate biominerals that are required for the normal sensation of gravity and linear acceleration. Vertigo and loss of balance may be attributed to degeneration of displacement of otoconia. The otopetrin family consists of three proteins, OTOP1, OTOP2 and OTOP3. These proteins have 12 putative transmembrane domains that are clustered into three otopetrin domains (OD-I, II and III). OTOP1 was the first described member of the Otopetrin family. Mutations of OTOP1 leads to absence of otoconia or otoliths, though inner ear development is normal. OTOP2 and OTOP3 share significant structural similarity with OTOP1 and may also play a role in the formation of mineralized structures. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ESLHRGPPGAEPHSTHPKEPCQDLTFTNLDALHTLSACPPNPGLVSPSPSDQREAVAIVSTPRSQWRRQCL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.