RHOXF1 (OTEX, PEPP1, Rhox Homeobox Family Member 1, Ovary-, Testis- and Epididymis-expressed Gene Protein, Paired-like Homeobox Protein PEPP-1, MGC119030, MGC119033), Clone: [4D12], Mouse, Monoclonal

Artikelnummer: USB-130766
Artikelname: RHOXF1 (OTEX, PEPP1, Rhox Homeobox Family Member 1, Ovary-, Testis- and Epididymis-expressed Gene Protein, Paired-like Homeobox Protein PEPP-1, MGC119030, MGC119033), Clone: [4D12], Mouse, Monoclonal
Artikelnummer: USB-130766
Hersteller Artikelnummer: 130766
Alternativnummer: USB-130766-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant protein corresponding to aa1-110 from human OTEX (NP_644811) with GST tag. MW of the GST tag alone is 26kD.
RHOXF1 may be a transcription factor involved in reproductive processes. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MARSLVHDTVFYCLSVYQVKISPTPQLGAASSAEGHVGQGAPGLMGNMNPEGGVNHENGMNRDGGMIPEGGGGNQEPRQQPQPPPEEPAQAAMEGPQPENMQPRTRRTKF Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [4D12]
NCBI: 139282
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.