Osteoprotegerin (Tumor Necrosis Factor Receptor Superfamily Member 11B, Osteoclastogenesis Inhibitory Factor, TNFRSF11B, OCIF, OPG) (FITC), Rabbit

Artikelnummer: USB-130764-FITC
Artikelname: Osteoprotegerin (Tumor Necrosis Factor Receptor Superfamily Member 11B, Osteoclastogenesis Inhibitory Factor, TNFRSF11B, OCIF, OPG) (FITC), Rabbit
Artikelnummer: USB-130764-FITC
Hersteller Artikelnummer: 130764-FITC
Alternativnummer: USB-130764-FITC-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human TNFRSF11B, aa1-401 (AAH30155.1).
Human OPG (Osteoprotegerin), also known as OCIF (Osteoclastogenesis inhibitory factor), is a member of the TNF receptor superfamily. It specifically acts on bone tissues and increases bone mineral density and bone volume associated with a decrease of active osteoclast number. Human OPG is a 20kD protein, comprising of 174aa residues. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 030155
UniProt: O00300
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).