Osteonectin (ON, Basement-membrane Protein 40, BM-40, Secreted Protein Acidic and Rich in Cysteine, SPARC) (APC), Rabbit

Artikelnummer: USB-130758-APC
Artikelname: Osteonectin (ON, Basement-membrane Protein 40, BM-40, Secreted Protein Acidic and Rich in Cysteine, SPARC) (APC), Rabbit
Artikelnummer: USB-130758-APC
Hersteller Artikelnummer: 130758-APC
Alternativnummer: USB-130758-APC-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human SPARC, aa1-303 (NP_003109.1).
SPARC (secreted protein acidic and rich in cysteine)/Osteonectin is a matricellular glycoprotein that modulates cellular interactions with the ECM and is expressed in tissues undergoing remodeling. It functions as a de-adhesive protein, as a modulator of growth factor activity, and as a cell-cycle inhibitor. It induces changes in endothelial cell shape via F-actin, coincident with the appearance of intercellular gaps, that provide a paracellular pathway for extravasation of macromolecules. Tumor growth is enhanced in mice lacking SPARC due to changes in the ECM that create a more permissive environment for tumor progression. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 003118
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).