Osteocalcin (Gamma-carboxyglutamic Acid-containing Protein, Bone Gla-protein, BGP, BGLAP) (MaxLight 650), IgG1, Clone: [2D4], Mouse, Monoclonal

Artikelnummer: USB-130757-ML650
Artikelname: Osteocalcin (Gamma-carboxyglutamic Acid-containing Protein, Bone Gla-protein, BGP, BGLAP) (MaxLight 650), IgG1, Clone: [2D4], Mouse, Monoclonal
Artikelnummer: USB-130757-ML650
Hersteller Artikelnummer: 130757-ML650
Alternativnummer: USB-130757-ML650-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IF, WB
Immunogen: Partial recombinant corresponding to aa52-100 from human BGLAP (NP_954642) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor(TM)647, DyLight(TM)649, Cy5(TM) and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm), Emission (676nm), Extinction Coefficient 250,000. Prior to the formation of calcified bone, noncollagenous proteins form in the extracellular bone matrix. Gamma-carboxyglutamic acid residues are formed by vitamin K, vitamin-D regulated calcium binding proteins containing residues of Gla. These residues are essential for the binding of calcium and constitue 1-2% of total bone protein. Osteocalcin itself binds strongly to apatite and calcium. Production of osteocalcin is expressed late in normal bone development and is characteristic of mature osteoblasts. Regular osteocalcin production has been shown to be linked to the p53 tumor suppressor gene. The p53 gene undergoes rearrangement in a high percentage of osteosarcomas, resulting in loss of its expression. The loss of p53 regulation inhibits further osteocalcin production. The absence of end-point differentiation in bone due to p53 rearrangements and lack of osteocalcin production may contribute to the maintenance of the tumorigenic phenotype in osteosarcomas. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2D4]
Isotyp: IgG1
NCBI: 199173
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)650.