Osteocalcin (Gamma-carboxyglutamic Acid-containing Protein, Bone Gla-protein, BGP, BGLAP) (HRP), IgG1, Clone: [2D4], Mouse, Monoclonal

Artikelnummer: USB-130757-HRP
Artikelname: Osteocalcin (Gamma-carboxyglutamic Acid-containing Protein, Bone Gla-protein, BGP, BGLAP) (HRP), IgG1, Clone: [2D4], Mouse, Monoclonal
Artikelnummer: USB-130757-HRP
Hersteller Artikelnummer: 130757-HRP
Alternativnummer: USB-130757-HRP-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant corresponding to aa52-100 from human BGLAP (NP_954642) with GST tag. MW of the GST tag alone is 26kD.
Prior to the formation of calcified bone, noncollagenous proteins form in the extracellular bone matrix. Gamma-carboxyglutamic acid residues are formed by vitamin K, vitamin-D regulated calcium binding proteins containing residues of Gla. These residues are essential for the binding of calcium and constitue 1-2% of total bone protein. Osteocalcin itself binds strongly to apatite and calcium. Production of osteocalcin is expressed late in normal bone development and is characteristic of mature osteoblasts. Regular osteocalcin production has been shown to be linked to the p53 tumor suppressor gene. The p53 gene undergoes rearrangement in a high percentage of osteosarcomas, resulting in loss of its expression. The loss of p53 regulation inhibits further osteocalcin production. The absence of end-point differentiation in bone due to p53 rearrangements and lack of osteocalcin production may contribute to the maintenance of the tumorigenic phenotype in osteosarcomas. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2D4]
Isotyp: IgG1
NCBI: 199173
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).