OSMR (Oncostatin-M-specific Receptor Subunit beta, Interleukin-31 Receptor Subunit beta, IL-31 Receptor Subunit beta, IL-31R Subunit beta, IL-31R-beta, IL-31RB, OSMRB) (FITC), Clone: [3E12], Mouse, Monoclonal

Artikelnummer: USB-130755-FITC
Artikelname: OSMR (Oncostatin-M-specific Receptor Subunit beta, Interleukin-31 Receptor Subunit beta, IL-31 Receptor Subunit beta, IL-31R Subunit beta, IL-31R-beta, IL-31RB, OSMRB) (FITC), Clone: [3E12], Mouse, Monoclonal
Artikelnummer: USB-130755-FITC
Hersteller Artikelnummer: 130755-FITC
Alternativnummer: USB-130755-FITC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: Partial recombinant corresponding to aa141-241 from OSMR (NP_003990) with GST tag. MW of the GST tag alone is 26kD.
Oncostatin M Receptor beta (OSM Rb) is a type I transmembrane protein that binds OSM with low affinity by itself and high affinity as an OSM Rb/gp130 heterodimer. OSM Rb is widely expressed and transduces signals involved in hematopoiesis, liver development, peripheral neuron repair and epithelial cell function. Mature human OSM Rb contains a 712aa extracellular domain (ECD) with one partial and one complete hematopoietin domain, an Ig-like domain and three fibronectin type-III domains, a 22aa transmembrane segment, and a 218aa cytoplasmic domain. Human OSM Rb ECD shares 55% aa sequence identity with mouse OSM Rb. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEP Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [3E12]
NCBI: 003999
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).