OSBPL8 (Oxysterol-binding Protein-related Protein 8, ORP-8, OSBP-related Protein 8, DKFZp686A11164, MGC126578, MGC133203, KIAA1451, ORP8, OSBP10) (PE), Clone: [4H6], Mouse, Monoclonal

Artikelnummer: USB-130750-PE
Artikelname: OSBPL8 (Oxysterol-binding Protein-related Protein 8, ORP-8, OSBP-related Protein 8, DKFZp686A11164, MGC126578, MGC133203, KIAA1451, ORP8, OSBP10) (PE), Clone: [4H6], Mouse, Monoclonal
Artikelnummer: USB-130750-PE
Hersteller Artikelnummer: 130750-PE
Alternativnummer: USB-130750-PE-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: Partial recombinant corresponding to aa244-347 from human OSBPL8 (NP_065892) with GST tag. MW of the GST tag alone is 26kD.
ORP8 is a member of the oxysterol-binding protein related protein family. In humans, the gene family consists of 12 members, and extensive splice variation increases the number of encoded protein products substantially. The ORPs have been implicated as sterol sensors that regulate a number of cellular functions including sterol and neutral lipid metabolism, intracellular lipid transport, membrane trafficking and cell signaling. ORP8 has been recently shown to act as a sterol sensor that affects the reverse cholesterol transport process via modulation of ABCA1 expression and macrophage cholesterol efflux. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEV Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [4H6]
NCBI: 020841
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).