OIP5 (Protein Mis18-beta, Cancer/Testis Antigen 86, CT86, Opa-interacting Protein 5, OIP-5, MIS18B) (FITC), Clone: [3G10-1D5], Mouse, Monoclonal

Artikelnummer: USB-130704-FITC
Artikelname: OIP5 (Protein Mis18-beta, Cancer/Testis Antigen 86, CT86, Opa-interacting Protein 5, OIP-5, MIS18B) (FITC), Clone: [3G10-1D5], Mouse, Monoclonal
Artikelnummer: USB-130704-FITC
Hersteller Artikelnummer: 130704-FITC
Alternativnummer: USB-130704-FITC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IP, WB
Immunogen: Full length recombinant corresponding to aa1-230 from OIP5 (AAH15050) with GST tag. MW of the GST tag alone is 26kD.
Required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis. Applications: Suitable for use in FLISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN* Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [3G10-1D5]
NCBI: 015050
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).