ODF2 (Outer Dense Fiber Protein 2, Cenexin, Outer Dense Fiber of Sperm Tails Protein 2) (Biotin), Clone: [1A1], Mouse, Monoclonal

Artikelnummer: USB-130693-BIOTIN
Artikelname: ODF2 (Outer Dense Fiber Protein 2, Cenexin, Outer Dense Fiber of Sperm Tails Protein 2) (Biotin), Clone: [1A1], Mouse, Monoclonal
Artikelnummer: USB-130693-BIOTIN
Hersteller Artikelnummer: 130693-Biotin
Alternativnummer: USB-130693-BIOTIN-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant corresponding to aa706-805 from human ODF2 (NP_002531) with GST tag. MW of the GST tag alone is 26kD.
Seems to be a major component of sperm tail outer dense fibers (ODF). ODFs are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail. May have a modulating influence on sperm motility. Functions as a general scaffold protein that is specifically localized at the distal/subdistal appendages of mother centrioles. Component of the centrosome matrix required for the localization of PLK1 and NIN to the centrosomes. Required for the formation and/or maintenance of normal CETN1 assembly. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [1A1]
NCBI: 002540
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.