ODF2 (Outer Dense Fiber Protein 2, Cenexin, Outer Dense Fiber of Sperm Tails Protein 2), Clone: [1A1], Mouse, Monoclonal

Artikelnummer: USB-130693
Artikelname: ODF2 (Outer Dense Fiber Protein 2, Cenexin, Outer Dense Fiber of Sperm Tails Protein 2), Clone: [1A1], Mouse, Monoclonal
Artikelnummer: USB-130693
Hersteller Artikelnummer: 130693
Alternativnummer: USB-130693-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant corresponding to aa706-805 from human ODF2 (NP_002531) with GST tag. MW of the GST tag alone is 26kD.
Seems to be a major component of sperm tail outer dense fibers (ODF). ODFs are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail. May have a modulating influence on sperm motility. Functions as a general scaffold protein that is specifically localized at the distal/subdistal appendages of mother centrioles. Component of the centrosome matrix required for the localization of PLK1 and NIN to the centrosomes. Required for the formation and/or maintenance of normal CETN1 assembly. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [1A1]
NCBI: 002540
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.