OCRL (Inositol Polyphosphate 5-phosphatase OCRL-1, Lowe Oculocerebrorenal Syndrome Protein, INPP5F, OCRL1), Clone: [4A6], Mouse, Monoclonal

Artikelnummer: USB-130689
Artikelname: OCRL (Inositol Polyphosphate 5-phosphatase OCRL-1, Lowe Oculocerebrorenal Syndrome Protein, INPP5F, OCRL1), Clone: [4A6], Mouse, Monoclonal
Artikelnummer: USB-130689
Hersteller Artikelnummer: 130689
Alternativnummer: USB-130689-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IHC, WB
Immunogen: Partial recombinant corresponding to aa146-240 from human OCRL (NP_000267) with GST tag. MW of the GST tag alone is 26kD.
This gene encodes a phosphatase enzyme that is involved in actin polymerization and is found in the trans-Golgi network. Mutations in this gene cause oculocerebrorenal syndrome of Lowe and also Dent disease. [provided by RefSeq] Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQT Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [4A6]
NCBI: 000276
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.