ID3 (1R21, BHLHB25, HEIR1, DNA-binding Protein Inhibitor ID-3, Class B Basic Helix-loop-helix Protein 25, Helix-loop-helix Protein HEIR-1, ID-like Protein Inhibitor HLH 1R21, Inhibitor of DNA Binding 3) (Biotin), Clone: [4G1], Mou

Artikelnummer: USB-128205-BIOTIN
Artikelname: ID3 (1R21, BHLHB25, HEIR1, DNA-binding Protein Inhibitor ID-3, Class B Basic Helix-loop-helix Protein 25, Helix-loop-helix Protein HEIR-1, ID-like Protein Inhibitor HLH 1R21, Inhibitor of DNA Binding 3) (Biotin), Clone: [4G1], Mou
Artikelnummer: USB-128205-BIOTIN
Hersteller Artikelnummer: 128205-Biotin
Alternativnummer: USB-128205-BIOTIN-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant corresponding to aa1-83 form human ID3 (NP_002158) with GST tag. MW of the GST tag alone is 26kD.
Members of the ID family of helix-loop-helix (HLH) proteins lack a basic DNA-binding domain and inhibit transcription through formation of nonfunctional dimers that are incapable of binding to DNA. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [4G1]
NCBI: 002167
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.